Heterogeneous Nuclear Ribonucleoprotein (A1 like) (HNRNPA1L2) (NM_001011725) Human Mass Spec Standard

CAT#: PH323427

HNRNPA1L2 MS Standard C13 and N15-labeled recombinant protein (NP_001011725)

Product Images

Coomassie blue staining of purified HNRNPA1L2 protein (Cat# TP323427). The protein was produced from HEK293T cells transfected with HNRNPA1L2 cDNA clone (Cat# RC223427) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223427
• Predicted MW: 34 kDa
• Protein Sequence:
  Sequence Link

  >RC223427 representing NM_001011725
  Red=Cloning site Green=Tags(s)
  
  MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDA
  AMNTTPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDR
  GSGKKRGFAFVTFDDHDSVDKIVIQKYHTVKGHNCEVRKALPKQEMASASSSQRGRRGSGNFGGGRGDGF
  GGNDNFGRGGNFSGRGGFGGSCGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGN
  FGGRSSGPYGGGGQYFAKPQNQGGYGVSSSSSSYGSGRRF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001011725
• RefSeq Size: 2224
• RefSeq ORF: 960
• Locus ID: 144983
• UniProt ID: Q32P51, A0A024QZ98
• Cytogenetics: 13q14.3
• Protein Pathways: Spliceosome