Adropin (ENHO) (NM_198573) Human Mass Spec Standard

CAT#: PH323456

ENHO MS Standard C13 and N15-labeled recombinant protein (NP_940975)

Product Images

Coomassie blue staining of purified ENHO protein (Cat# TP323456). The protein was produced from HEK293T cells transfected with ENHO cDNA clone (Cat# RC223456) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223456
• Predicted MW: 7.7 kDa
• Protein Sequence:
  Sequence Link

  >RC223456 representing NM_198573
  Red=Cloning site Green=Tags(s)
  
  MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEG
  SYLLQP
  
  TRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_940975
• RefSeq Size: 1093
• RefSeq ORF: 228
• Synonyms: C9orf165; UNQ470
• Locus ID: 375704
• UniProt ID: Q6UWT2
• Cytogenetics: 9p13.3
• Protein Families: Transmembrane