Methyltransferase like 6 (METTL6) (NM_152396) Human Mass Spec Standard

CAT#: PH323504

METTL6 MS Standard C13 and N15-labeled recombinant protein (NP_689609)

Product Images

Coomassie blue staining of purified METTL6 protein (Cat# TP323504). The protein was produced from HEK293T cells transfected with METTL6 cDNA clone (Cat# RC223504) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223504
• Predicted MW: 33.1 kDa
• Protein Sequence:
  Sequence Link

  >RC223504 representing NM_152396
  Red=Cloning site Green=Tags(s)
  
  MASLQRKGLQARILTSEEEEKLKRDQTLVSDFKQQKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEEL
  RSCREFEDQKLTMLEAGCGVGNCLFPLLEEDPNIFAYACDFSPRAIEYVKQNPLYDTERCKVFQCDLTKD
  DLLDHVPPESVDVVMLIFVLSAVHPDKMHLVLQNIYKVLKPGKSVLFRDYGLYDHAMLRFKASSKLGENF
  YVRQDGTRSYFFTDDFLAQLFMDTGYEEVVNEYVFRETVNKKEGLCVPRVFLQSKFLKPPKNPSPVVLGL
  DPKS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_689609
• RefSeq Size: 2499
• RefSeq ORF: 852
• Synonyms: MGC24132
• Locus ID: 131965
• UniProt ID: Q8TCB7
• Cytogenetics: 3p25.1
• Protein Families: Druggable Genome
• Protein Pathways: Androgen and estrogen metabolism, Histidine metabolism, Selenoamino acid metabolism, Tyrosine metabolism