Exosome Component 9 (EXOSC9) (NM_001034194) Human Mass Spec Standard

CAT#: PH323537

EXOSC9 MS Standard C13 and N15-labeled recombinant protein (NP_001029366)

Product Images

Coomassie blue staining of purified EXOSC9 protein (Cat# TP323537). The protein was produced from HEK293T cells transfected with EXOSC9 cDNA clone (Cat# RC223537) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223537
• Predicted MW: 50.6 kDa
• Protein Sequence:
  Sequence Link

  >RC223537 representing NM_001034194
  Red=Cloning site Green=Tags(s)
  
  MKETPLSNCERRFLLRAIEEKKRLDGRQTYDYRNIRISFGTDYGCCIVELGKTRVLGQVSCELVSPKLNR
  ATEGILFFNLELSQMAAPAFEPGRQSDLLVKLNRLMERCLRNSKCIDTESLCVVAGEKVWQIRVDLHLLN
  HDGNIIDAASIAAIVALCHFRRPDVSVQGDEVTLYTPEERDPVPLSIHHMPICVSFAFFQQGTYLLVDPN
  EREERVMDGLLVIAMNKHREICTIQSSGGIMLLKDQVLRCSKIAGVKVAEITELILKALENDQKVRKEGG
  KFGFAESIANQRITAFKMEKAPIDTSDVEEKAEEIIAEAEPPSEVVSTPVLWTPGTAQIGEGVENSWGDL
  EDSEKEDDEGGGDQAIILDGIKMDTGVEVSDIGSQELGFHHVGQTGLEFLTSDAPIILSDSEEEEMIILE
  PDKNPKKIRTQTTSAKQEKAPSKKPVKRRKKKRAAN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001029366
• RefSeq Size: 1644
• RefSeq ORF: 1368
• Synonyms: p5; p6; PCH1D; PM/Scl-75; PMSCL1; RRP45; Rrp45p
• Locus ID: 5393
• UniProt ID: Q06265
• Cytogenetics: 4q27
• Summary: 'This gene encodes a component of the human exosome, a exoribonuclease complex which processes and degrades RNA in the nucleus and cytoplasm. This component may play a role in mRNA degradation and the polymyositis/scleroderma autoantigen complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2011]'
• Protein Families: Stem cell - Pluripotency
• Protein Pathways: RNA degradation