BMF (NM_033503) Human Mass Spec Standard

CAT#: PH323634

BMF MS Standard C13 and N15-labeled recombinant protein (NP_277038)

Product Images

Coomassie blue staining of purified BMF protein (Cat# TP323634). The protein was produced from HEK293T cells transfected with BMF cDNA clone (Cat# RC223634) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223634
• Predicted MW: 20.3 kDa
• Protein Sequence:
  Sequence Link

  >RC223634 representing NM_033503
  Red=Cloning site Green=Tags(s)
  
  MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKAT
  QTLSPASPSPGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCI
  ADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNGAGPR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_277038
• RefSeq Size: 4551
• RefSeq ORF: 552
• Synonyms: FLJ00065
• Locus ID: 90427
• UniProt ID: Q96LC9
• Cytogenetics: 15q15.1
• Summary: The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein contains a single BCL2 homology domain 3 (BH3), and has been shown to bind BCL2 proteins and function as an apoptotic activator. This protein is found to be sequestered to myosin V motors by its association with dynein light chain 2, which may be important for sensing intracellular damage and triggering apoptosis. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome