Annexin A11 (ANXA11) (NM_145869) Human Mass Spec Standard
CAT#: PH323654
ANXA11 MS Standard C13 and N15-labeled recombinant protein (NP_665876)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223654 |
Predicted MW | 54.2 kDa |
Protein Sequence |
>RC223654 representing NM_145869
Red=Cloning site Green=Tags(s) MSYPGYPPPPGGYPPAAPGGGPWGGAAYPPPPSMPPIGLDNVATYAGQFNQDYLSGMAANMSGTFGGANM PNLYPGAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPVPGQPMPPPGQQP PGAYPGQPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVTPAVPPTQFGSRGTITDAPGFDPLRDAEVLR KAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDIYE IKEAIKGVGTDEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDEST NVDMSLAQRDAQELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEE GMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTS GDYRKILLKICGGND myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_665876 |
RefSeq Size | 2731 |
RefSeq ORF | 1515 |
Synonyms | ALS23; ANX11; CAP-50; CAP50 |
Locus ID | 311 |
UniProt ID | P50995, Q5T0G8 |
Cytogenetics | 10q22.3 |
Summary | 'This gene encodes a member of the annexin family, a group of calcium-dependent phospholipid-binding proteins. Annexins have unique N-terminal domains and conserved C-terminal domains, which contain calcium-dependent phospholipid-binding sites. The encoded protein is a 56-kD antigen recognized by sera from patients with various autoimmune diseases. Several transcript variants encoding two different isoforms have been identified. [provided by RefSeq, Dec 2015]' |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403443 | ANXA11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC407850 | ANXA11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC420097 | ANXA11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC430151 | ANXA11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY403443 | Transient overexpression lysate of annexin A11 (ANXA11), transcript variant c |
USD 495.00 |
|
LY407850 | Transient overexpression lysate of annexin A11 (ANXA11), transcript variant b |
USD 325.00 |
|
LY420097 | Transient overexpression lysate of annexin A11 (ANXA11), transcript variant a |
USD 325.00 |
|
LY430151 | Transient overexpression lysate of annexin A11 (ANXA11), transcript variant b |
USD 325.00 |
|
PH303530 | ANXA11 MS Standard C13 and N15-labeled recombinant protein (NP_665875) |
USD 2,055.00 |
|
PH312191 | ANXA11 MS Standard C13 and N15-labeled recombinant protein (NP_001148) |
USD 2,055.00 |
|
TP303530 | Recombinant protein of human annexin A11 (ANXA11), transcript variant b |
USD 867.00 |
|
TP312191 | Recombinant protein of human annexin A11 (ANXA11), transcript variant a |
USD 748.00 |
|
TP323654 | Recombinant protein of human annexin A11 (ANXA11), transcript variant c |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review