REG3G (NM_001008387) Human Mass Spec Standard
CAT#: PH323733
REG3G MS Standard C13 and N15-labeled recombinant protein (NP_001008388)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223733 |
Predicted MW | 19.3 kDa |
Protein Sequence |
>RC223733 protein sequence
Red=Cloning site Green=Tags(s) MLPPMALPSVSWMLLSCLILLCQVQGEETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQK RPSGKLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTI LNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001008388 |
RefSeq Size | 955 |
RefSeq ORF | 525 |
Synonyms | LPPM429; PAP-1B; PAP1B; PAP IB; PAPIB; REG-III; REG III; UNQ429 |
Locus ID | 130120 |
UniProt ID | Q6UW15 |
Cytogenetics | 2p12 |
Summary | This gene encodes a member of the regenerating islet-derived genes (REG)3 protein family. These proteins are secreted, C-type lectins with a carbohydrate recognition domain and N-terminal signal peptide. The protein encoded by this gene is an antimicrobial lectin with activity against Gram-positive bacteria. Alternative splicing results in multiple transcript variants encoding multiple isoforms. [provided by RefSeq, Nov 2014] |
Protein Families | Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404935 | REG3G HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC423414 | REG3G HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY404935 | Transient overexpression lysate of regenerating islet-derived 3 gamma (REG3G), transcript variant 2 |
USD 396.00 |
|
LY423414 | Transient overexpression lysate of regenerating islet-derived 3 gamma (REG3G), transcript variant 1 |
USD 396.00 |
|
PH323686 | REG3G MS Standard C13 and N15-labeled recombinant protein (NP_940850) |
USD 2,055.00 |
|
TP323686 | Recombinant protein of human regenerating islet-derived 3 gamma (REG3G), transcript variant 2 |
USD 399.00 |
|
TP323733 | Recombinant protein of human regenerating islet-derived 3 gamma (REG3G), transcript variant 1 |
USD 748.00 |
|
TP721105 | Purified recombinant protein of Human regenerating islet-derived 3 gamma (REG3G), transcript variant 2 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review