ARMS2 (NM_001099667) Human Mass Spec Standard

CAT#: PH323747

ARMS2 MS Standard C13 and N15-labeled recombinant protein (NP_001093137)

Product Images

Coomassie blue staining of purified ARMS2 protein (Cat# TP323747). The protein was produced from HEK293T cells transfected with ARMS2 cDNA clone (Cat# RC223747) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223747
• Predicted MW: 11.3 kDa
• Protein Sequence:
  Sequence Link

  >RC223747 representing NM_001099667
  Red=Cloning site Green=Tags(s)
  
  MLRLYPGPMVTEAEGKGGPEMASLSSSVVPVSFISTLRESVLDPGVGGEGASDKQRSKLSLSHSMIPAAK
  IHTELCLPAFFSPAGTQRRFQQPQHHLTLSIIHTAAR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001093137
• RefSeq Size: 823
• RefSeq ORF: 321
• Synonyms: ARMD8
• Locus ID: 387715
• UniProt ID: P0C7Q2
• Cytogenetics: 10q26.13
• Summary: This gene encodes a small secreted protein specific to primates. This protein is a component of the choroidal extracellular matrix of the eye. Mutations in this gene are associated with age-related macular degeneration. [provided by RefSeq, Sep 2017]