CPNE1 (NM_152927) Human Mass Spec Standard
CAT#: PH323828
CPNE1 MS Standard C13 and N15-labeled recombinant protein (NP_690904)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223828 |
Predicted MW | 59.1 kDa |
Protein Sequence |
>RC223828 representing NM_152927
Red=Cloning site Green=Tags(s) MAHCVTLVQLSISCDHLIDKDIGSKSDPLCVLLQDVGGGSWAELGRTERVRNCSSPEFSKTLQLEYRFET VQKLRFGIYDIDNKTPELRDDDFLGGAECSLGQIVSSQVLTLPLMLKPGKPAGRGTITVSAQELKDNRVV TMEVEARNLDKKDFLGKSDPFLEFFRQGDGKWHLVYRSEVIKNNLNPTWKRFSVPVQHFCGGNPSTPIQV QCSDYDSDGSHDLIGTFHTSLAQLQAVPAEFECIHPEKQQKKKSYKNSGTIRVKICRVETEYSFLDYVMG GCQINFTVGVDFTGSNGDPSSPDSLHYLSPTGVNEYLMALWSVGSVVQDYDSDKLFPAFGFGAQVPPDWQ VSHEFALNFNPSNPYCAGIQGIVDAYRQALPQVRLYGPTNFAPIINHVARFAAQAAHQGTASQYFMLLLL TDGAVTDVEATREAVVRASNLPMSVIIVGVGGADFEAMEQLDADGGPLHTRSGQAAARDIVQFVPYRRFQ NAPREALAQTVLAEVPTQLVSYFRAQGWAPLKPLPPSAKDPAQAPQA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_690904 |
RefSeq Size | 2107 |
RefSeq ORF | 1611 |
Synonyms | COPN1; CPN1 |
Locus ID | 8904 |
UniProt ID | Q99829 |
Cytogenetics | 20q11.22 |
Summary | Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene encodes a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the encoded protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking. This gene and the gene for RNA binding motif protein 12 overlap at map location 20q11.21. Alternate splicing results in multiple transcript variants encoding different proteins. [provided by RefSeq, Aug 2008] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407221 | CPNE1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC407223 | CPNE1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC407224 | CPNE1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC430247 | CPNE1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC430249 | CPNE1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY407221 | Transient overexpression lysate of copine I (CPNE1), transcript variant 2 |
USD 325.00 |
|
LY407223 | Transient overexpression lysate of copine I (CPNE1), transcript variant 5 |
USD 325.00 |
|
LY407224 | Transient overexpression lysate of copine I (CPNE1), transcript variant 6 |
USD 325.00 |
|
LY430247 | Transient overexpression lysate of copine I (CPNE1), transcript variant 2 |
USD 325.00 |
|
LY430249 | Transient overexpression lysate of copine I (CPNE1), transcript variant 5 |
USD 325.00 |
|
PH312736 | CPNE1 MS Standard C13 and N15-labeled recombinant protein (NP_690905) |
USD 2,055.00 |
|
PH312892 | CPNE1 MS Standard C13 and N15-labeled recombinant protein (NP_690902) |
USD 2,055.00 |
|
PH321043 | CPNE1 MS Standard C13 and N15-labeled recombinant protein (NP_690906) |
USD 2,055.00 |
|
PH321253 | CPNE1 MS Standard C13 and N15-labeled recombinant protein (NP_690903) |
USD 2,055.00 |
|
TP300203 | Purified recombinant protein of Homo sapiens copine I (CPNE1), transcript variant 7 |
USD 748.00 |
|
TP311574 | Purified recombinant protein of Homo sapiens copine I (CPNE1), transcript variant 8 |
USD 748.00 |
|
TP312736 | Purified recombinant protein of Homo sapiens copine I (CPNE1), transcript variant 5 |
USD 748.00 |
|
TP312892 | Purified recombinant protein of Homo sapiens copine I (CPNE1), transcript variant 1 |
USD 823.00 |
|
TP321043 | Recombinant protein of human copine I (CPNE1), transcript variant 6 |
USD 748.00 |
|
TP321253 | Purified recombinant protein of Homo sapiens copine I (CPNE1), transcript variant 2 |
USD 823.00 |
|
TP323828 | Purified recombinant protein of Homo sapiens copine I (CPNE1), transcript variant 4 |
USD 748.00 |
|
TP721021 | Purified recombinant protein of Human copine I (CPNE1), transcript variant 5 |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review