BTN1A1 (NM_001732) Human Mass Spec Standard

CAT#: PH323852

BTN1A1 MS Standard C13 and N15-labeled recombinant protein (NP_001723)

Product Images

Coomassie blue staining of purified BTN1A1 protein (Cat# TP323852). The protein was produced from HEK293T cells transfected with BTN1A1 cDNA clone (Cat# RC223852) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223852
• Predicted MW: 58.8 kDa
• Protein Sequence:
  Sequence Link

  >RC223852 representing NM_001732
  Red=Cloning site Green=Tags(s)
  
  MAVFPSSGLPRCLLTLILLQLPKLDSAPFDVIGPPEPILAVVGEDAELPCRLSPNASAEHLELRWFRKKV
  SPAVLVHRDGREQEAEQMPEYRGRATLVQDGIAKGRVALRIRGVRVSDDGEYTCFFREDGSYEEALVHLK
  VAALGSDPHISMQVQENGEICLECTSVGWYPEPQVQWRTSKGEKFPSTSESRNPDEEGLFTVAASVIIRD
  TSTKNVSCYIQNLLLGQEKKVEISIPASSLPRLTPWIVAVAVILMVLGLLTIGSIFFTWRLYNERPRERR
  NEFSSKERLLEELKWKKATLHAVDVTLDPDTAHPHLFLYEDSKSVRLEDSRQKLPEKTERFDSWPCVLGR
  ETFTSGRHYWEVEVGDRTDWAIGVCRENVMKKGFDPMTPENGFWAVELYGNGYWALTPLRTPLPLAGPPR
  RVGIFLDYESGDISFYNMNDGSDIYTFSNVTFSGPLRPFFCLWSSGKKPLTICPIADGPERVTVIANAQD
  LSKEIPLSPMGEESAPRDADTLHSKLIPTQPSQGAP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001723
• RefSeq Size: 2901
• RefSeq ORF: 1578
• Synonyms: BT; BTN; BTN1
• Locus ID: 696
• UniProt ID: Q13410, Q4VAN2
• Cytogenetics: 6p22.2
• Summary: 'Butyrophilin is the major protein associated with fat droplets in the milk. It is a member of the immunoglobulin superfamily. It may have a cell surface receptor function. The human butyrophilin gene is localized in the major histocompatibility complex (MHC) class I region of 6p and may have arisen relatively recently in evolution by the shuffling of exons between 2 ancestral gene families [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Transmembrane