TNNT3 (NM_001042782) Human Mass Spec Standard
CAT#: PH323893
TNNT3 MS Standard C13 and N15-labeled recombinant protein (NP_001036247)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223893 |
Predicted MW | 29.7 kDa |
Protein Sequence |
>RC223893 protein sequence
Red=Cloning site Green=Tags(s) MSDEEVEQVEEQYEEEEEAQEEEEVQEEEKPRPKLTAPKIPEGEKVDFDDIQKKRQNKDLMELQALIDSH FEARKKEEEELVALKERIEKRRAERAEQQRIRAEKERERQNRLAEEKARREEEDAKRRAEDDLKKKKALS SMGANYSSYLAKADQKRGKKQTAREMKKKILAERRKPLNIDHLGEDKLRDKAKELWETLHQLEIDKFEFG EKLKRQKYDITTLRSRIDQAQKHSKKAGTPAKGKVGGRWK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001036247 |
RefSeq Size | 1193 |
RefSeq ORF | 750 |
Synonyms | beta-TnTF; DA2B2; TNTF |
Locus ID | 7140 |
UniProt ID | P45378 |
Cytogenetics | 11p15.5 |
Summary | 'The binding of Ca(2+) to the trimeric troponin complex initiates the process of muscle contraction. Increased Ca(2+) concentrations produce a conformational change in the troponin complex that is transmitted to tropomyosin dimers situated along actin filaments. The altered conformation permits increased interaction between a myosin head and an actin filament which, ultimately, produces a muscle contraction. The troponin complex has protein subunits C, I, and T. Subunit C binds Ca(2+) and subunit I binds to actin and inhibits actin-myosin interaction. Subunit T binds the troponin complex to the tropomyosin complex and is also required for Ca(2+)-mediated activation of actomyosin ATPase activity. There are 3 different troponin T genes that encode tissue-specific isoforms of subunit T for fast skeletal-, slow skeletal-, and cardiac-muscle. This gene encodes fast skeletal troponin T protein; also known as troponin T type 3. Alternative splicing results in multiple transcript variants encoding additional distinct troponin T type 3 isoforms. A developmentally regulated switch between fetal/neonatal and adult troponin T type 3 isoforms occurs. Additional splice variants have been described but their biological validity has not been established. Mutations in this gene may cause distal arthrogryposis multiplex congenita type 2B (DA2B). [provided by RefSeq, Oct 2009]' |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402019 | TNNT3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC420809 | TNNT3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC420811 | TNNT3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425799 | TNNT3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402019 | Transient overexpression lysate of troponin T type 3 (skeletal, fast) (TNNT3), transcript variant 1 |
USD 396.00 |
|
LY420809 | Transient overexpression lysate of troponin T type 3 (skeletal, fast) (TNNT3), transcript variant 3 |
USD 396.00 |
|
LY420811 | Transient overexpression lysate of troponin T type 3 (skeletal, fast) (TNNT3), transcript variant 4 |
USD 396.00 |
|
LY425799 | Transient overexpression lysate of troponin T type 3 (skeletal, fast) (TNNT3), transcript variant 3 |
USD 396.00 |
|
PH312563 | TNNT3 MS Standard C13 and N15-labeled recombinant protein (NP_001036245) |
USD 2,055.00 |
|
PH316642 | TNNT3 MS Standard C13 and N15-labeled recombinant protein (NP_006748) |
USD 2,055.00 |
|
TP312563 | Recombinant protein of human troponin T type 3 (skeletal, fast) (TNNT3), transcript variant 3 |
USD 823.00 |
|
TP316642 | Recombinant protein of human troponin T type 3 (skeletal, fast) (TNNT3), transcript variant 1 |
USD 748.00 |
|
TP323893 | Recombinant protein of human troponin T type 3 (skeletal, fast) (TNNT3), transcript variant 4 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review