TIPRL (NM_152902) Human Mass Spec Standard

CAT#: PH323912

TIPRL MS Standard C13 and N15-labeled recombinant protein (NP_690866)

Product Images

Coomassie blue staining of purified TIPRL protein (Cat# TP323912). The protein was produced from HEK293T cells transfected with TIPRL cDNA clone (Cat# RC223912) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223912
• Predicted MW: 31.3 kDa
• Protein Sequence:
  Sequence Link

  >RC223912 representing NM_152902
  Red=Cloning site Green=Tags(s)
  
  MMIHGFQSSHRDFCFGPWKLTASKTHIMKSADVEKLADELHMPSLPEMMFGDNVLRIQHGSGFGIEFNAT
  DALRCVNNYQGMLKVACAEEWQESRTEGEHSKEVIKPYDWTYTTDYKGTLLGESLKLKVVPTTDHIDTEK
  LKAREQIKFFEEVLLFEDELHDHGVSSLSVKIRVMPSSFFLLLRFFLRIDGVLIRMNDTRLYHEADKTYM
  LREYTSRESKISSLMHVPPSLFTEPNEISQYLPIKEAVCEKLIFPERIDPNPADSQKSTQVE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_690866
• RefSeq Size: 3032
• RefSeq ORF: 816
• Synonyms: TIP; TIP41; TIPRL1
• Locus ID: 261726
• UniProt ID: O75663
• Cytogenetics: 1q24.2
• Summary: TIPRL is an inhibitory regulator of protein phosphatase-2A (PP2A) (see PPP2CA; MIM 176915), PP4 (see PPP4C; MIM 602035), and PP6 (see PPP6C; MIM 612725) (McConnell et al., 2007 [PubMed 17384681]). [supplied by OMIM, Nov 2010]