PQBP1 (NM_001032383) Human Mass Spec Standard

CAT#: PH324043

PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001027555)

Product Images

Coomassie blue staining of purified PQBP1 protein (Cat# TP324043). The protein was produced from HEK293T cells transfected with PQBP1 cDNA clone (Cat# RC224043) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224043
• Predicted MW: 30.5 kDa
• Protein Sequence:
  Sequence Link

  >RC224043 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSCGLPYYWNADT
  DLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSHEKLDRGHDKSDRGHDKSDR
  DRERGYDKVDRERERDRERDRDRGYDKADREEGKERRHHRREELAPYPKSKKAVSRKDEELDPMDPSSYS
  DAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001027555
• RefSeq Size: 1093
• RefSeq ORF: 795
• Synonyms: MRX2; MRX55; MRXS3; MRXS8; NPW38; RENS1; SHS
• Locus ID: 10084
• UniProt ID: O60828, A0A0S2Z4V5
• Cytogenetics: Xp11.23
• Summary: This gene encodes a nuclear polyglutamine-binding protein that is involved with transcription activation. The encoded protein contains a WW domain. Mutations in this gene have been found in patients with Renpenning syndrome 1 and other syndromes with X-linked cognitive disability. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene. [provided by RefSeq, Nov 2009]
• Protein Families: Transcription Factors
• Protein Pathways: Spliceosome