PQBP1 (NM_001032382) Human Mass Spec Standard
CAT#: PH323994
PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001027554)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223994 |
Predicted MW | 30.5 kDa |
Protein Sequence |
>RC223994 protein sequence
Red=Cloning site Green=Tags(s) MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSCGLPYYWNADT DLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSHEKLDRGHDKSDRGHDKSDR DRERGYDKVDRERERDRERDRDRGYDKADREEGKERRHHRREELAPYPKSKKAVSRKDEELDPMDPSSYS DAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001027554 |
RefSeq Size | 1082 |
RefSeq ORF | 795 |
Synonyms | MRX2; MRX55; MRXS3; MRXS8; NPW38; RENS1; SHS |
Locus ID | 10084 |
UniProt ID | O60828, A0A0S2Z4V5 |
Cytogenetics | Xp11.23 |
Summary | This gene encodes a nuclear polyglutamine-binding protein that is involved with transcription activation. The encoded protein contains a WW domain. Mutations in this gene have been found in patients with Renpenning syndrome 1 and other syndromes with X-linked cognitive disability. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene. [provided by RefSeq, Nov 2009] |
Protein Families | Transcription Factors |
Protein Pathways | Spliceosome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417119 | PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC422317 | PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC422318 | PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC422319 | PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC422320 | PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425530 | PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425531 | PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425532 | PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425533 | PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC432617 | PQBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY417119 | Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 1 |
USD 396.00 |
|
LY422317 | Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 2 |
USD 396.00 |
|
LY422318 | Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 3 |
USD 396.00 |
|
LY422319 | Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 4 |
USD 396.00 |
|
LY422320 | Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 5 |
USD 396.00 |
|
LY425530 | Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 2 |
USD 396.00 |
|
LY425531 | Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 3 |
USD 396.00 |
|
LY425532 | Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 4 |
USD 396.00 |
|
LY425533 | Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 5 |
USD 396.00 |
|
LY432617 | Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 10 |
USD 396.00 |
|
PH304269 | PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001027553) |
USD 2,055.00 |
|
PH321161 | PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001027556) |
USD 2,055.00 |
|
PH323943 | PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_005701) |
USD 2,055.00 |
|
PH324043 | PQBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001027555) |
USD 2,055.00 |
|
TP304269 | Purified recombinant protein of Homo sapiens polyglutamine binding protein 1 (PQBP1), transcript variant 2 |
USD 823.00 |
|
TP321161 | Purified recombinant protein of Homo sapiens polyglutamine binding protein 1 (PQBP1), transcript variant 5 |
USD 748.00 |
|
TP323943 | Recombinant protein of human polyglutamine binding protein 1 (PQBP1), transcript variant 1 |
USD 748.00 |
|
TP323994 | Purified recombinant protein of Homo sapiens polyglutamine binding protein 1 (PQBP1), transcript variant 3 |
USD 748.00 |
|
TP324043 | Purified recombinant protein of Homo sapiens polyglutamine binding protein 1 (PQBP1), transcript variant 4 |
USD 748.00 |
|
TP329617 | Purified recombinant protein of Homo sapiens polyglutamine binding protein 1 (PQBP1), transcript variant 10. |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review