EFCBP2 (NECAB2) (NM_019065) Human Mass Spec Standard

CAT#: PH324047

NECAB2 MS Standard C13 and N15-labeled recombinant protein (NP_061938)

Product Images

Coomassie blue staining of purified NECAB2 protein (Cat# TP324047). The protein was produced from HEK293T cells transfected with NECAB2 cDNA clone (Cat# RC224047) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224047
• Predicted MW: 43 kDa
• Protein Sequence:
  Sequence Link

  >RC224047 representing NM_019065
  Red=Cloning site Green=Tags(s)
  
  MCERAARLCRAGAHRLLREPPQQGRALGGLLRWVGARMGEPRESLAPAAPADPGPASPRGGTAVILDIFR
  RADKNDDGKLSLEEFQLFFADGVLNEKELEDLFHTIDSDNTNHVDTKELCDYFVDHMGDYEDVLASLETL
  NHSVLKAMGYTKKVYEGGSNVDQFVTRFLLKETANQIQSLLSSVESAVEAIEEQTSQLRQNHIKPSHSAA
  QTWCGSPTPASAPNHKLMAMEQGKTLPSATEDAKEEGLEAQISRLAELIGRLESKALWFDLQQRLSDEDG
  TNMHLQLVRQEMAVCPEQLSEFLDSLRQYLRGTTGVRNCFHITAVRLSDGFTFVIYEFWETEEAWKRHLQ
  SPLCKAFRHVKVDTLSQPEALSRILVPAAWCTVGRD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_061938
• RefSeq Size: 1636
• RefSeq ORF: 1158
• Synonyms: EFCBP2; stip-2
• Locus ID: 54550
• UniProt ID: Q7Z6G3
• Cytogenetics: 16q23.3
• Summary: The protein encoded by this gene is a neuronal calcium-binding protein that binds to and modulates the function of at least two receptors, adenosine A(2A) receptor and metabotropic glutamate receptor type 5. [provided by RefSeq, Jul 2016]