DIABLO (NM_138930) Human Mass Spec Standard

CAT#: PH324145

DIABLO MS Standard C13 and N15-labeled recombinant protein (NP_620308)

Product Images

Coomassie blue staining of purified DIABLO protein (Cat# TP324145). The protein was produced from HEK293T cells transfected with DIABLO cDNA clone (Cat# RC224145) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224145
• Predicted MW: 21.7 kDa
• Protein Sequence:
  Sequence Link

  >RC224145 representing NM_138930
  Red=Cloning site Green=Tags(s)
  
  MKSDFYFQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGK
  MNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQ
  VEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_620308
• RefSeq Size: 2455
• RefSeq ORF: 558
• Synonyms: DFNA64; SMAC
• Locus ID: 56616
• UniProt ID: Q9NR28, Q502X2
• Cytogenetics: 12q24.31
• Summary: This gene encodes an inhibitor of apoptosis protein (IAP)-binding protein. The encoded mitochondrial protein enters the cytosol when cells undergo apoptosis, and allows activation of caspases by binding to inhibitor of apoptosis proteins. Overexpression of the encoded protein sensitizes tumor cells to apoptosis. A mutation in this gene is associated with young-adult onset of nonsyndromic deafness-64. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2013]
• Protein Families: Transmembrane