CADM3 (NM_021189) Human Mass Spec Standard

CAT#: PH324162

CADM3 MS Standard C13 and N15-labeled recombinant protein (NP_067012)

Product Images

Coomassie blue staining of purified CADM3 protein (Cat# TP324162). The protein was produced from HEK293T cells transfected with CADM3 cDNA clone (Cat# RC224162) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224162
• Predicted MW: 46.8 kDa
• Protein Sequence:
  Sequence Link

  >RC224162 representing NM_021189
  Red=Cloning site Green=Tags(s)
  
  MGAPAASLLLLLLLFACCWAPGGANLSQDGYWQEQDLELGTLAPLDEAISSTVWSSPDMLASQDSQPWTS
  DETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVTSTPHELSISISNVALADEG
  EYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEP
  TRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPDPPHPRE
  GQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYKAYYTLNV
  NDPSPVPSSSSTYHAIIGGIVAFIVFLLLIMLIFLGHYLIRHKGTYLTHEAKGSDDAPDADTAIINAEGG
  QSGGDDKKEYFI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_067012
• RefSeq Size: 2540
• RefSeq ORF: 1296
• Synonyms: BIgR; IGSF4B; Necl-1; NECL1; synCAM3; TSLL1
• Locus ID: 57863
• UniProt ID: Q8N126
• Cytogenetics: 1q23.2
• Summary: The protein encoded by this gene is a calcium-independent cell-cell adhesion protein that can form homodimers or heterodimers with other nectin proteins. The encoded protein has both homophilic and heterophilic cell-cell adhesion activity. This gene is reported to be a tumor suppressor gene. [provided by RefSeq, Oct 2016]
• Protein Families: Transmembrane
• Protein Pathways: Cell adhesion molecules (CAMs)