Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-CADM3 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CADM3. |
Rabbit Polyclonal Anti-CADM3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CADM3 antibody: synthetic peptide directed towards the middle region of human CADM3. Synthetic peptide located within the following region: KDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSV |
CADM3 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CADM3 |
CADM3 Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Modifications | Unmodified |
Active filters
Target Symbol
- CADM3