Alkaline Phosphatase (ALPI) (NM_001631) Human Mass Spec Standard

CAT#: PH324178

ALPI MS Standard C13 and N15-labeled recombinant protein (NP_001622)

Product Images

Coomassie blue staining of purified ALPI protein (Cat# TP324178). The protein was produced from HEK293T cells transfected with ALPI cDNA clone (Cat# RC224178) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224178
• Predicted MW: 56.81 kDa
• Protein Sequence:
  Sequence Link

  >RC224178 representing NM_001631
  Red=Cloning site Green=Tags(s)
  
  MQGPWVLLLLGLRLQLSLGVIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTA
  TRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQC
  NTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLI
  SNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQS
  VTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEA
  VMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVF
  NSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPY
  TACDLAPPACTTDAAHPVAASLPLLAGTLLLLGASAAP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001622
• RefSeq Size: 2516
• RefSeq ORF: 1584
• Synonyms: IAP
• Locus ID: 248
• UniProt ID: P09923, A0A024R4A2
• Cytogenetics: 2q37.1
• Summary: 'There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The intestinal alkaline phosphatase gene encodes a digestive brush-border enzyme. This enzyme is a component of the gut mucosal defense system and is thought to function in the detoxification of lipopolysaccharide, and in the prevention of bacterial translocation in the gut. [provided by RefSeq, Dec 2014]'
• Protein Families: Druggable Genome
• Protein Pathways: Folate biosynthesis, Metabolic pathways