STEAP3 (NM_018234) Human Mass Spec Standard
CAT#: PH324274
STEAP3 MS Standard C13 and N15-labeled recombinant protein (NP_060704)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224274 |
Predicted MW | 54.6 kDa |
Protein Sequence |
>RC224274 protein sequence
Red=Cloning site Green=Tags(s) MPEEMDKPLISLHLVDSDSSLAKVPDEAPKVGILGSGDFARSLATRLVGSGFKVVVGSRNPKRTARLFPS AAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRESNAEYLASLFPTC TVVKAFNVISAWTLQAGPRDGNRQVPICGDQPEAKRAVSEMALAMGFMPVDMGSLASAWEVEAMPLRLLP AWKVPTLLALGLFVCFYAYNFVRDVLQPYVQESQNKFFKLPVSVVNTTLPCVAYVLLSLVYLPGVLAAAL QLRRGTKYQRFPDWLDHWLQHRKQIGLLSFFCAALHALYSFCLPLRRAHRYDLVNLAVKQVLANKSHLWV EEEVWRMEIYLSLGVLALGTLSLLAVTSLPSIANSLNWREFSFVQSSLGFVALVLSTLHTLTYGWTRAFE ESRYKFYLPPTFTLTLLVPCVVILAKALFLLPCISRRLARIRRGWERESTIKFTLPTDHALAEKTSHV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_060704 |
RefSeq Size | 3938 |
RefSeq ORF | 1464 |
Synonyms | AHMIO2; dudlin-2; dudulin-2; pHyde; STMP3; TSAP6 |
Locus ID | 55240 |
UniProt ID | Q658P3, A1P3F0 |
Cytogenetics | 2q14.2 |
Summary | This gene encodes a multipass membrane protein that functions as an iron transporter. The encoded protein can reduce both iron (Fe3+) and copper (Cu2+) cations. This protein may mediate downstream responses to p53, including promoting apoptosis. Deficiency in this gene can cause anemia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2015] |
Protein Families | Transmembrane |
Protein Pathways | p53 signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405328 | STEAP3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC413214 | STEAP3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC423432 | STEAP3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425238 | STEAP3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY405328 | Transient overexpression lysate of STEAP family member 3 (STEAP3), transcript variant 1 |
USD 495.00 |
|
LY413214 | Transient overexpression lysate of STEAP family member 3 (STEAP3), transcript variant 2 |
USD 325.00 |
|
LY423432 | Transient overexpression lysate of STEAP family member 3 (STEAP3), transcript variant 3 |
USD 325.00 |
|
LY425238 | Transient overexpression lysate of STEAP family member 3 (STEAP3), transcript variant 3 |
USD 325.00 |
|
PH310595 | STEAP3 MS Standard C13 and N15-labeled recombinant protein (NP_001008410) |
USD 2,055.00 |
|
TP310595 | Recombinant protein of human STEAP family member 3 (STEAP3), transcript variant 3 |
USD 867.00 |
|
TP324274 | Recombinant protein of human STEAP family member 3 (STEAP3), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review