GIPC (GIPC1) (NM_202468) Human Mass Spec Standard

CAT#: PH324373

GIPC1 MS Standard C13 and N15-labeled recombinant protein (NP_974197)

Product Images

Coomassie blue staining of purified GIPC1 protein (Cat# TP324373). The protein was produced from HEK293T cells transfected with GIPC1 cDNA clone (Cat# RC224373) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224373
• Predicted MW: 36 kDa
• Protein Sequence:
  Sequence Link

  >RC224373 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPLGLGRRKKAPPLVENEEAEPGRGGLGVGEPGPLGGGGSGGPQMGLPPPPPALRPRLVFHTQLAHGSPT
  GRIEGFTNVKELYGKIAEAFRLPTAEVMFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKSE
  DALGLTITDNGAGYAFIKRIKEGSVIDHIHLISVGDMIEAINGQSLLGCRHYEVARLLKELPRGRTFTLK
  LTEPRKAFDMISQRSAGGRPGSGPQLGTGRGTLRLRSRGPATVEDLPSAFEEKAIEKVDDLLESYMGIRD
  TELAATMVELGKDKRNPDELAEALDERLGDFAFPDEFVFDVWGAIGDAKVGRY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_974197
• RefSeq Size: 1908
• RefSeq ORF: 999
• Synonyms: C19orf3; GIPC; GLUT1CBP; Hs.6454; IIP-1; NIP; RGS19IP1; SEMCAP; SYNECTIIN; SYNECTIN; TIP-2
• Locus ID: 10755
• UniProt ID: O14908, A0A024R7I0, A8K2I7
• Cytogenetics: 19p13.12
• Summary: GIPC1 is a scaffolding protein that regulates cell surface receptor expression and trafficking (Lee et al., 2008 [PubMed 18775991]). [supplied by OMIM, Apr 2009]
• Protein Families: Druggable Genome