ATP1B4 (NM_012069) Human Mass Spec Standard

CAT#: PH324408

ATP1B4 MS Standard C13 and N15-labeled recombinant protein (NP_036201)

Product Images

Coomassie blue staining of purified ATP1B4 protein (Cat# TP324408). The protein was produced from HEK293T cells transfected with ATP1B4 cDNA clone (Cat# RC224408) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224408
• Predicted MW: 40.9 kDa
• Protein Sequence:
  Sequence Link

  >RC224408 representing NM_012069
  Red=Cloning site Green=Tags(s)
  
  MRRQLRSRRAPSFPYSYRYRLDDPDEANQNYLADEEEEAEEEARVTVVPKSEEEEEEEEKEEEEEEEKEE
  EEGQGQPTGNAWWQKLQIMSEYLWDPERRMFLARTGLILLIYFFFYASLAAVITLCMYTLFLTISPYIPT
  FTERVKPPGVMIRPFAHSLNFNFNVSEPDTWQHYVISLNGFLQGYNDSLQEEMNVDCPPGQYFIQDGNED
  EDKKACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGDPVKVSCKVQRGDENDIRSISY
  YPESASFDLRYYPYYGKLTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGVINDVINDRFVGRVIFTLN
  IET
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036201
• RefSeq Size: 3857
• RefSeq ORF: 1059
• Synonyms: ATPase, (Na+)/K+ transporting, beta 4 polypeptide; OTTHUMP00000023940; X,K-ATPase beta-m subunit
• Locus ID: 23439
• UniProt ID: Q9UN42
• Cytogenetics: Xq24
• Summary: This gene has been found in all vertebrate genomes sequenced to date. However, this gene has undergone a change in function in placental mammals compared to other species. Specifically, in fish, avian, and amphibian species, this gene encodes plasma membrane-bound beta-subunits of Na,K-ATPase. In placental mammals, the encoded protein interacts with the nuclear transcriptional coregulator SKIP and may be involved in the regulation of TGF-beta signaling. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2010]
• Protein Families: Transmembrane
• Protein Pathways: Cardiac muscle contraction