Mammaglobin A (SCGB2A2) (NM_002411) Human Mass Spec Standard

CAT#: PH324550

SCGB2A2 MS Standard C13 and N15-labeled recombinant protein (NP_002402)

Product Images

Coomassie blue staining of purified SCGB2A2 protein (Cat# TP324550). The protein was produced from HEK293T cells transfected with SCGB2A2 cDNA clone (Cat# RC224550) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224550
• Predicted MW: 10.5 kDa
• Protein Sequence:
  Sequence Link

  >RC224550 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQT
  DETLSNVEVFMQLIYDSSLCDLF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002402
• RefSeq Size: 517
• RefSeq ORF: 279
• Synonyms: MGB1; UGB2
• Locus ID: 4250
• UniProt ID: Q13296
• Cytogenetics: 11q12.3
• Summary: ''