GPR141 (NM_181791) Human Mass Spec Standard

CAT#: PH324590

GPR141 MS Standard C13 and N15-labeled recombinant protein (NP_861456)

Product Images

Coomassie blue staining of purified GPR141 protein (Cat# TP324590). The protein was produced from HEK293T cells transfected with GPR141 cDNA clone (Cat# RC224590) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224590
• Predicted MW: 35.3 kDa
• Protein Sequence:
  Sequence Link

  >RC224590 representing NM_181791
  Red=Cloning site Green=Tags(s)
  
  MPGHNTSRNSSCDPIVTPHLISLYFIVLIGGLVGVISILFLLVKMNTRSVTTMAVINLVVVHSVFLLTVP
  FRLTYLIKKTWMFGLPFCKFVSAMLHIHMYLTFLFYVVILVTRYLIFFKCKDKVEFYRKLHAVAASAGMW
  TLVIVIVVPLVVSRYGIHEEYNEEHCFKFHKELAYTYVKIINYMIVIFVIAVAVILLVFQVFIIMLMVQK
  LRHSLLSHQEFWAQLKNLFFIGVILVCFLPYQFFRIYYLNVVTHSNACNSKVAFYNEIFLSVTAISCYDL
  LLFVFGGSHWFKQKIIGLWNCVLCR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_861456
• RefSeq Size: 918
• RefSeq ORF: 915
• Synonyms: PGR13
• Locus ID: 353345
• UniProt ID: Q7Z602
• Cytogenetics: 7p14.1
• Summary: GPR141 is a member of the rhodopsin family of G protein-coupled receptors (GPRs) (Fredriksson et al., 2003 [PubMed 14623098]). [supplied by OMIM, Mar 2008]
• Protein Families: Druggable Genome, Transmembrane