VSTM1 (NM_198481) Human Mass Spec Standard

CAT#: PH324612

VSTM1 MS Standard C13 and N15-labeled recombinant protein (NP_940883)

Product Images

Coomassie blue staining of purified VSTM1 protein (Cat# TP324612). The protein was produced from HEK293T cells transfected with VSTM1 cDNA clone (Cat# RC224612) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224612
• Predicted MW: 24.4 kDa
• Protein Sequence:
  Sequence Link

  >RC224612 representing NM_198481
  Red=Cloning site Green=Tags(s)
  
  MTAEFLSLLCLGLCLGYEDEKKNEKPPKPSLHAWPSSVVEAESNVTLKCQAHSQNVTFVLRKVNDSGYKQ
  EQSSAENEAEFPFTDLKPKDAGRYFCAYKTTASHEWSESSEHLQLVVTDKHDELEAPSMKTDTRTIFVAI
  FSCISILLLFLSVFIIYRCSQHGSSSEESTKRTSHSKLPEXEAAEADLSNMERVSLSTADPQGVTYAELS
  TSALSEAASDTTQEPPGSHEYAALKV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_940883
• RefSeq Size: 1024
• RefSeq ORF: 708
• Synonyms: SIRL-1; SIRL1; UNQ3033
• Locus ID: 284415
• UniProt ID: Q6UX27
• Cytogenetics: 19q13.42
• Summary: Isoform 1: Inhibitory immune receptor involved in the regulation of phagocytes. [UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane