SPAG11B (NM_058201) Human Mass Spec Standard
CAT#: PH324764
SPAG11B MS Standard C13 and N15-labeled recombinant protein (NP_478108)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224764 |
Predicted MW | 12.1 kDa |
Protein Sequence |
>RC224764 representing NM_058201
Red=Cloning site Green=Tags(s) MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKRDLLPPRTPPY QGDVPPGIRNTICRMQQGICRLFFCHSGEKKRDICSDPWNRCCVSNTDEEGKEKPEMDGRSGI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_478108 |
RefSeq Size | 718 |
RefSeq ORF | 399 |
Synonyms | EDDM2B; EP2; EP2C; EP2D; HE2; HE2C; SPAG11; SPAG11A |
Locus ID | 10407 |
UniProt ID | Q08648 |
Cytogenetics | 8p23.1 |
Summary | This gene encodes several androgen-dependent, epididymis-specific secretory proteins. The specific functions of these proteins have not been determined, but they are thought to be involved in sperm maturation. Some of the isoforms contain regions of similarity to beta-defensins, a family of antimicrobial peptides. The gene is located on chromosome 8p23 near the defensin gene cluster. Alternative splicing of this gene results in seven transcript variants encoding different isoforms. Two different N-terminal and five different C-terminal protein sequences are encoded by the splice variants. Two additional variants have been described, but their full length sequences have not been determined. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409232 | SPAG11B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY409232 | Transient overexpression lysate of sperm associated antigen 11B (SPAG11B), transcript variant D |
USD 396.00 |
|
TP324764 | Recombinant protein of human sperm associated antigen 11B (SPAG11B), transcript variant D |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review