Antibodies

View as table Download

Rabbit Polyclonal Anti-SPAG11B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SPAG11B Antibody: synthetic peptide directed towards the N terminal of human SPAG11B. Synthetic peptide located within the following region: MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNG

Rabbit Polyclonal Anti-SPAG11B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SPAG11B Antibody is: synthetic peptide directed towards the N-terminal region of Human SPAG11B. Synthetic peptide located within the following region: VALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKRDLLP