SPAG11B Rabbit Polyclonal Antibody

CAT#: TA335556

Rabbit Polyclonal Anti-SPAG11B Antibody

Product Images

Host: Rabbit; Target Name: SPAG11B; Sample Tissue: Large Intestine Tumor lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SPAG11B Antibody is: synthetic peptide directed towards the N-terminal region of Human SPAG11B. Synthetic peptide located within the following region: VALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKRDLLP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 14 kDa
• Gene Name: sperm associated antigen 11B
• Database Link:
  NP_057596
  Entrez Gene 10407 Human
  UniProt ID Q6PDA7
• Background: SPAG11B is one of several androgen-dependent, epididymis-specific secretory proteins. The specific functions of these proteins have not been determined, but they are thought to be involved in sperm maturation. Some of the isoforms contain regions of similarity to beta-defensins, a family of antimicrobial peptides.
• Synonyms: EDDM2B; EP2; EP2C; EP2D; HE2; HE2C; SPAG11
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Secreted Protein