SPAG11B Rabbit Polyclonal Antibody

CAT#: TA335410

Rabbit Polyclonal Anti-SPAG11B Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "SPAG11B"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-SPAG11B Antibody: synthetic peptide directed towards the N terminal of human SPAG11B. Synthetic peptide located within the following region: MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 15 kDa
Gene Name sperm associated antigen 11B
Background SPAG11B is one of several androgen-dependent, epididymis-specific secretory proteins. The specific functions of these proteins have not been determined, but they are thought to be involved in sperm maturation. Some of the isoforms contain regions of similarity to beta-defensins, a family of antimicrobial peptides.This gene encodes several androgen-dependent, epididymis-specific secretory proteins. The specific functions of these proteins have not been determined, but they are thought to be involved in sperm maturation. Some of the isoforms contain regions of similarity to beta-defensins, a family of antimicrobial peptides. The gene is located on chromosome 8p23 near the defensin gene cluster. Alternative splicing of this gene results in seven transcript variants encoding different isoforms. Two different N-terminal and five different C-terminal protein sequences are encoded by the splice variants. Two additional variants have been described, but their full length sequences have not been determined.
Synonyms EDDM2B; EP2; EP2C; EP2D; HE2; HE2C; SPAG11
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Secreted Protein

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.