OSTF1 (NM_012383) Human Mass Spec Standard

CAT#: PH324885

OSTF1 MS Standard C13 and N15-labeled recombinant protein (NP_036515)

Product Images

Coomassie blue staining of purified OSTF1 protein (Cat# TP324885). The protein was produced from HEK293T cells transfected with OSTF1 cDNA clone (Cat# RC224885) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224885
• Predicted MW: 23.6 kDa
• Protein Sequence:
  Sequence Link

  >RC224885 representing NM_012383
  Red=Cloning site Green=Tags(s)
  
  MSKPPPKPVKPGQVKVFRALYTFEPRTPDELYFEEGDIIYITDMSDTNWWKGTSKGRTGLIPSNYVAEQA
  ESIDNPLHEAAKRGNLSWLRECLDNRVGVNGLDKAGSTALYWACHGGHKDIVEMLFTQPNIELNQQNKLG
  DTALHAAAWKGYADIVQLLLAKGARTDLRNIEKKLAFDMATNAACASLLKKKQGTDAVRTLSNAEDYLDD
  EDSD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036515
• RefSeq Size: 901
• RefSeq ORF: 642
• Synonyms: bA235O14.1; OSF; SH3P2
• Locus ID: 26578
• UniProt ID: Q92882
• Cytogenetics: 9q21.13
• Summary: Osteoclast-stimulating factor-1 is an intracellular protein produced by osteoclasts that indirectly induces osteoclast formation and bone resorption (Reddy et al., 1998 [PubMed 10092216]). [supplied by OMIM, Mar 2008]