MARS2 (NM_138395) Human Mass Spec Standard

CAT#: PH324966

MARS2 MS Standard C13 and N15-labeled recombinant protein (NP_612404)

Product Images

Coomassie blue staining of purified MARS2 protein (Cat# TP324966). The protein was produced from HEK293T cells transfected with MARS2 cDNA clone (Cat# RC224966) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224966
• Predicted MW: 66.6 kDa
• Protein Sequence:
  Sequence Link

  >RC224966 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLRTSVLRLLGRTGASRLSLLEDFGPRYYSSGSLSAGDDACDVRAYFTTPIFYVNAAPHIGHLYSALLAD
  ALCRHRRLRGPSTAATRFSTGTDEHGLKIQQAAATAGLAPTELCDRVSEQFQQLFQEAGISCTDFIRTTE
  ARHRVAVQHFWGVLKSRGLLYKGVYEGWYCASDECFLPEAKVTQQPGPSGDSFPVSLESGHPVSWTKEEN
  YIFRLSQFRKPLQRWLRGNPQAITPEPFHHVVLQWLDEELPDLSVSRRSSHLHWGIPVPGDDSQTIYVWL
  DALVNYLTVIGYPNAEFKSWWPATSHIIGKDILKFHAIYWPAFLLGAGMSPPQRICVHSHWTVCGQKMSK
  SLGNVVDPRTCLNRYTVDGFRYFLLRQGVPNWDCDYYDEKVVKLLNSELADALGGLLNRCTAKRINPSET
  YPAFCTTCFPSEPGLVGPSVRAQAEDYALVSAVATLPKQVADHYDNFRIYKALEAVSSCVRQTNGFVQRH
  APWKLNWESPVDAPWLGTVLHVALECLRVFGTLLQPVTPSLADKLLSRLGVSASERSLGELYFLPRFYGH
  PCPFEGRRLGPETGLLFPRLDQSRTWLVKAHRT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_612404
• RefSeq Size: 3102
• RefSeq ORF: 1779
• Synonyms: COXPD25; MetRS; mtMetRS
• Locus ID: 92935
• UniProt ID: Q96GW9
• Cytogenetics: 2q33.1
• Summary: This gene produces a mitochondrial methionyl-tRNA synthetase protein that is encoded by the nuclear genome and imported to the mitochondrion. This protein likely functions as a monomer and is predicted to localize to the mitochondrial matrix. Mutations in this gene are associated with the autosomal recessive neurodegenerative disease spastic ataxia-3 (SPAX3). [provided by RefSeq, Apr 2014]
• Protein Families: Druggable Genome
• Protein Pathways: Aminoacyl-tRNA biosynthesis, Selenoamino acid metabolism