C1orf144 (SZRD1) (NM_001114600) Human Mass Spec Standard
CAT#: PH325131
C1orf144 MS Standard C13 and N15-labeled recombinant protein (NP_001108072)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225131 |
Predicted MW | 16.8 kDa |
Protein Sequence |
>RC225131 representing NM_001114600
Red=Cloning site Green=Tags(s) MEDEEVAESWEEAADSGEIDRRLEKKLKITQKESRKSKSPPKVPIVIQDDSLPAGPPPQIRILKRPTSNG VVSSPNSTSRPTLPVKSLAQREAEYAEARKRILGSASPEEEQEKPILDRPTRISQPEDSRQPNNVIRQPL GPDGSQGFKQRR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001108072 |
RefSeq ORF | 456 |
Synonyms | C1orf144 |
Locus ID | 26099 |
UniProt ID | Q7Z422 |
Cytogenetics | 1p36.13 |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414455 | SZRD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY414455 | Transient overexpression lysate of chromosome 1 open reading frame 144 (C1orf144), transcript variant 2 |
USD 396.00 |
|
PH305077 | C1orf144 MS Standard C13 and N15-labeled recombinant protein (NP_056424) |
USD 2,055.00 |
|
TP305077 | Recombinant protein of human chromosome 1 open reading frame 144 (C1orf144), transcript variant 2 |
USD 823.00 |
|
TP325131 | Purified recombinant protein of Homo sapiens chromosome 1 open reading frame 144 (C1orf144), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review