TMEM240 (NM_001114748) Human Mass Spec Standard

CAT#: PH325178

C1orf70 MS Standard C13 and N15-labeled recombinant protein (NP_001108220)

Product Images

Coomassie blue staining of purified TMEM240 protein (Cat# TP325178). The protein was produced from HEK293T cells transfected with TMEM240 cDNA clone (Cat# RC225178) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC225178
• Predicted MW: 19.7 kDa
• Protein Sequence:
  Sequence Link

  >RC225178 representing NM_001114748
  Red=Cloning site Green=Tags(s)
  
  MSMSANTMIFMILGASVVMAIACLMDMNALLDRFHNYILPHLRGEDRVCHCNCGRHHIHYVIPYDGDQSV
  VDASENYFVTDSVTKQEIDLMLGLLLGFCISWFLVWMDGVLHCAVRAWRAGRRYDGSWTWLPKLCSLREL
  GRRPHRPFEEAAGNMVHVKQKLYHNGHPSPRHL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001108220
• RefSeq ORF: 519
• Synonyms: C1orf70; SCA21
• Locus ID: 339453
• UniProt ID: Q5SV17
• Cytogenetics: 1p36.33
• Summary: This gene encodes a transmembrane-domain containing protein found in the brain and cerebellum. Mutations in this gene result in spinocerebellar ataxia 21. [provided by RefSeq, Dec 2014]