MAGP1 (MFAP2) (NM_001135247) Human Mass Spec Standard

CAT#: PH325196

MFAP2 MS Standard C13 and N15-labeled recombinant protein (NP_001128719)

Product Images

Coomassie blue staining of purified MFAP2 protein (Cat# TP325196). The protein was produced from HEK293T cells transfected with MFAP2 cDNA clone (Cat# RC225196) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC225196
• Predicted MW: 20.83 kDa
• Protein Sequence:
  Sequence Link

  >RC225196 representing NM_001135247
  Red=Cloning site Green=Tags(s)
  
  MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDYQEVTPRPSEEQFQFQSQQQV
  QQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRT
  VCAHEELLRADLCRDKFSKCGVMASSGLCQSVAASCARSCGSC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001128719
• RefSeq ORF: 549
• Synonyms: MAGP; MAGP-1; MAGP1
• Locus ID: 4237
• UniProt ID: P55001
• Cytogenetics: 1p36.13
• Summary: 'Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Sep 2008]'
• Protein Families: Secreted Protein