Germany
Japan
United Kingdom
China
PARK7 (NM_001123377) Human Mass Spec Standard
CAT#: PH325206
PARK7 MS Standard C13 and N15-labeled recombinant protein (NP_001116849)
Product Images
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC225206 |
| Predicted MW | 19.9 kDa |
| Protein Sequence |
>RC225206 protein sequence
Red=Cloning site Green=Tags(s) MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVV VLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYT YSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_001116849 |
| RefSeq Size | 921 |
| RefSeq ORF | 567 |
| Synonyms | DJ-1; DJ1; GATD2; HEL-S-67p |
| Locus ID | 11315 |
| UniProt ID | Q99497, V9HWC2 |
| Cytogenetics | 1p36.23 |
| Summary | The product of this gene belongs to the peptidase C56 family of proteins. It acts as a positive regulator of androgen receptor-dependent transcription. It may also function as a redox-sensitive chaperone, as a sensor for oxidative stress, and it apparently protects neurons against oxidative stress and cell death. Defects in this gene are the cause of autosomal recessive early-onset Parkinson disease 7. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protease |
| Protein Pathways | Parkinson's disease |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402122 | PARK7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC426614 | PARK7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY402122 | Transient overexpression lysate of Parkinson disease (autosomal recessive, early onset) 7 (PARK7), transcript variant 1 |
USD 396.00 |
|
| LY426614 | Transient overexpression lysate of Parkinson disease (autosomal recessive, early onset) 7 (PARK7), transcript variant 2 |
USD 396.00 |
|
| TP301645 | Recombinant protein of human Parkinson disease (autosomal recessive, early onset) 7 (PARK7), transcript variant 1 |
USD 823.00 |
|
| TP325206 | Recombinant protein of human Parkinson disease (autosomal recessive, early onset) 7 (PARK7), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review