PARK7 (NM_001123377) Human Mass Spec Standard
CAT#: PH325206
PARK7 MS Standard C13 and N15-labeled recombinant protein (NP_001116849)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225206 |
Predicted MW | 19.9 kDa |
Protein Sequence |
>RC225206 protein sequence
Red=Cloning site Green=Tags(s) MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVV VLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYT YSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001116849 |
RefSeq Size | 921 |
RefSeq ORF | 567 |
Synonyms | DJ-1; DJ1; GATD2; HEL-S-67p |
Locus ID | 11315 |
UniProt ID | Q99497, V9HWC2 |
Cytogenetics | 1p36.23 |
Summary | The product of this gene belongs to the peptidase C56 family of proteins. It acts as a positive regulator of androgen receptor-dependent transcription. It may also function as a redox-sensitive chaperone, as a sensor for oxidative stress, and it apparently protects neurons against oxidative stress and cell death. Defects in this gene are the cause of autosomal recessive early-onset Parkinson disease 7. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protease |
Protein Pathways | Parkinson's disease |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402122 | PARK7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC426614 | PARK7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY402122 | Transient overexpression lysate of Parkinson disease (autosomal recessive, early onset) 7 (PARK7), transcript variant 1 |
USD 325.00 |
|
LY426614 | Transient overexpression lysate of Parkinson disease (autosomal recessive, early onset) 7 (PARK7), transcript variant 2 |
USD 325.00 |
|
TP301645 | Recombinant protein of human Parkinson disease (autosomal recessive, early onset) 7 (PARK7), transcript variant 1 |
USD 823.00 |
|
TP325206 | Recombinant protein of human Parkinson disease (autosomal recessive, early onset) 7 (PARK7), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review