MAD2L2 (NM_001127325) Human Mass Spec Standard

CAT#: PH325253

MAD2L2 MS Standard C13 and N15-labeled recombinant protein (NP_001120797)

Product Images

Coomassie blue staining of purified MAD2L2 protein (Cat# TP325253). The protein was produced from HEK293T cells transfected with MAD2L2 cDNA clone (Cat# RC225253) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC225253
• Predicted MW: 24.3 kDa
• Protein Sequence:
  Sequence Link

  >RC225253 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHC
  VKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHN
  PPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKG
  S
  
  TRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001120797
• RefSeq Size: 1196
• RefSeq ORF: 633
• Synonyms: FANCV; MAD2B; POLZ2; REV7
• Locus ID: 10459
• UniProt ID: Q9UI95, A0A024R4I4
• Cytogenetics: 1p36.22
• Summary: The protein encoded by this gene is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. The encoded protein, which is similar to MAD2L1, is capable of interacting with ADAM9, ADAM15, REV1, and REV3 proteins. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation