THTPA (NM_001126339) Human Mass Spec Standard
CAT#: PH325287
THTPA MS Standard C13 and N15-labeled recombinant protein (NP_001119811)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225287 |
Predicted MW | 25.6 kDa |
Protein Sequence |
>RC225287 protein sequence
Red=Cloning site Green=Tags(s) MAQGLIEVERKFLPGPGTEERLQELGGTLEYRVTFRDTYYDTPELSLMQADHWLRRREDSGWELKCPGAA GVLGPHTEYKELTAEPTIVAQLCKVLRADGLGAGDVAAVLGPLGLQEVASFVTKRSAWKLVLLGADEEEP QLRVDLDTADFGYAVGEVEALVHEEAEVPTALEKIHRLSSMLGVPAQETAPAKLIVYLQRFRPQDYQRLL EVNSSRERPQETEDPDHCLG myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001119811 |
RefSeq Size | 1829 |
RefSeq ORF | 690 |
Synonyms | THTP; THTPASE |
Locus ID | 79178 |
UniProt ID | Q9BU02 |
Cytogenetics | 14q11.2 |
Summary | This gene encodes an enzyme which catalyzes the biosynthesis of thiamine disphophate (vitamin B1) by hydrolysis of thiamine triphosphate. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2011] |
Protein Pathways | Metabolic pathways, Thiamine metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411308 | THTPA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426679 | THTPA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY411308 | Transient overexpression lysate of thiamine triphosphatase (THTPA), transcript variant 1 |
USD 396.00 |
|
LY426679 | Transient overexpression lysate of thiamine triphosphatase (THTPA), transcript variant 2 |
USD 396.00 |
|
PH300849 | THTPA MS Standard C13 and N15-labeled recombinant protein (NP_077304) |
USD 2,055.00 |
|
TP300849 | Recombinant protein of human thiamine triphosphatase (THTPA), transcript variant 1 |
USD 823.00 |
|
TP325287 | Recombinant protein of human thiamine triphosphatase (THTPA), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review