Heme oxygenase 2 (HMOX2) (NM_001127205) Human Mass Spec Standard

CAT#: PH325452

HMOX2 MS Standard C13 and N15-labeled recombinant protein (NP_001120677)

Product Images

Coomassie blue staining of purified HMOX2 protein (Cat# TP325452). The protein was produced from HEK293T cells transfected with HMOX2 cDNA clone (Cat# RC225452) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC225452
• Predicted MW: 36 kDa
• Protein Sequence:
  Sequence Link

  >RC225452 representing NM_001127205
  Red=Cloning site Green=Tags(s)
  
  MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKGNIKKELFKLA
  TTALYFTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHY
  IGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPSTGEGTQFYLFENVDNAQQFKQLYRARMNALD
  LNMKTKERIVEEANKAFEYNMQIFNELDQAGSTLARETLEDGFPVHDGKGDMRKCPFYAAEQDKGALEGS
  SCPFRTAMAVLRKPSLQFILAAGVALAAGLLAWYYM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001120677
• RefSeq Size: 1776
• RefSeq ORF: 948
• Synonyms: HO-2
• Locus ID: 3163
• UniProt ID: P30519
• Cytogenetics: 16p13.3
• Summary: 'Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family. Several alternatively spliced transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq, Oct 2013]'
• Protein Families: Transmembrane
• Protein Pathways: Porphyrin and chlorophyll metabolism