p73 (TP73) (NM_001126242) Human Mass Spec Standard
CAT#: PH325696
TP73 MS Standard C13 and N15-labeled recombinant protein (NP_001119714)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC225696 |
| Predicted MW | 47.5 kDa |
| Protein Sequence |
>RC225696 representing NM_001126242
Red=Cloning site Green=Tags(s) MLYVGDPARHLATAQFNLLSSTMDQMSSRAASASPYTPEHAASVPTHSPYAQPSSTFDTMSPAPVIPSNT DYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTD VVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCN SSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYREQQALNESSAKNGAASKRA FKQSPPAVPALGAGVKKRRHGDEDTYYLQVRGRENFEILMKLKESLELMELVPQPLVDSYRQQQQLLQRP PRDAQQPWPRSASQRRDEQQPQRPVHGLGVPLHSATPLPRRPQPRQFFNRIGVSKLHRVFHLPRVTEHLP PAEPDH myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_001119714 |
| RefSeq ORF | 1278 |
| Synonyms | P73 |
| Locus ID | 7161 |
| UniProt ID | O15350, A0A0C4DFW9 |
| Cytogenetics | 1p36.32 |
| Summary | 'This gene encodes a member of the p53 family of transcription factors involved in cellular responses to stress and development. It maps to a region on chromosome 1p36 that is frequently deleted in neuroblastoma and other tumors, and thought to contain multiple tumor suppressor genes. The demonstration that this gene is monoallelically expressed (likely from the maternal allele), supports the notion that it is a candidate gene for neuroblastoma. Many transcript variants resulting from alternative splicing and/or use of alternate promoters have been found for this gene, but the biological validity and the full-length nature of some variants have not been determined. [provided by RefSeq, Feb 2011]' |
| Protein Families | Druggable Genome, Transcription Factors |
| Protein Pathways | Neurotrophin signaling pathway, p53 signaling pathway |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417321 | TP73 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC426670 | TP73 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY417321 | Transient overexpression lysate of tumor protein p73 (TP73), transcript variant 1 |
USD 665.00 |
|
| LY426670 | Transient overexpression lysate of tumor protein p73 (TP73), transcript variant 4 |
USD 436.00 |
|
| PH320864 | TP73 MS Standard C13 and N15-labeled recombinant protein (NP_005418) |
USD 2,055.00 |
|
| TP320864 | Recombinant protein of human tumor protein p73 (TP73), transcript variant 1 |
USD 788.00 |
|
| TP325696 | Purified recombinant protein of Homo sapiens tumor protein p73 (TP73), transcript variant 4 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China