Estrogen Related Receptor gamma (ESRRG) (NM_001134285) Human Mass Spec Standard
CAT#: PH325714
ESRRG MS Standard C13 and N15-labeled recombinant protein (NP_001127757)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC225714 |
| Predicted MW | 48.6 kDa |
| Protein Sequence |
>RC225714 protein sequence
Red=Cloning site Green=Tags(s) MSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQNGLDSPPLYPSAPILGG SGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYS CPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKP YNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQS AWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIA LANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGK VPMHKLFLEMLEAKV myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_001127757 |
| RefSeq Size | 5336 |
| RefSeq ORF | 1305 |
| Synonyms | ERR-gamma; ERR3; ERRg; ERRgamma; NR3B3 |
| Locus ID | 2104 |
| UniProt ID | P62508, F1D8R6 |
| Cytogenetics | 1q41 |
| Summary | 'This gene encodes a member of the estrogen receptor-related receptor (ESRR) family, which belongs to the nuclear hormone receptor superfamily. All members of the ESRR family share an almost identical DNA binding domain, which is composed of two C4-type zinc finger motifs. The ESRR members are orphan nuclear receptors; they bind to the estrogen response element and steroidogenic factor 1 response element, and activate genes controlled by both response elements in the absence of any ligands. The ESRR family is closely related to the estrogen receptor (ER) family. They share target genes, co-regulators and promoters, and by targeting the same set of genes, the ESRRs seem to interfere with the ER-mediated estrogen response in various ways. It has been reported that the family member encoded by this gene functions as a transcriptional activator of DNA cytosine-5-methyltransferases 1 (Dnmt1) expression by direct binding to its response elements in the DNMT1 promoters, modulates cell proliferation and estrogen signaling in breast cancer, and negatively regulates bone morphogenetic protein 2-induced osteoblast differentiation and bone formation. Multiple alternatively spliced transcript variants have been identified, which mainly differ at the 5' end and some of which encode protein isoforms differing in the N-terminal region. [provided by RefSeq, Aug 2011]' |
| Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400557 | ESRRG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC404215 | ESRRG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LY400557 | Transient overexpression lysate of estrogen-related receptor gamma (ESRRG), transcript variant 1 |
USD 665.00 |
|
| LY404215 | Transient overexpression lysate of estrogen-related receptor gamma (ESRRG), transcript variant 2 |
USD 665.00 |
|
| PH312143 | ESRRG MS Standard C13 and N15-labeled recombinant protein (NP_996317) |
USD 2,055.00 |
|
| PH314462 | ESRRG MS Standard C13 and N15-labeled recombinant protein (NP_996318) |
USD 2,055.00 |
|
| PH318233 | ESRRG MS Standard C13 and N15-labeled recombinant protein (NP_001429) |
USD 2,055.00 |
|
| TP312143 | Recombinant protein of human estrogen-related receptor gamma (ESRRG), transcript variant 2 |
USD 788.00 |
|
| TP314462 | Purified recombinant protein of Homo sapiens estrogen-related receptor gamma (ESRRG), transcript variant 3 |
USD 748.00 |
|
| TP318233 | Recombinant protein of human estrogen-related receptor gamma (ESRRG), transcript variant 1 |
USD 748.00 |
|
| TP325714 | Purified recombinant protein of Homo sapiens estrogen-related receptor gamma (ESRRG), transcript variant 4 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China