CD36 (NM_001127443) Human Mass Spec Standard
CAT#: PH325799
CD36 MS Standard C13 and N15-labeled recombinant protein (NP_001120915)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225799 |
Predicted MW | 53.1 kDa |
Protein Sequence |
>RC225799 protein sequence
Red=Cloning site Green=Tags(s) MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDV QNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNL AVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADG VYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFE SDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYAS PDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETG TIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001120915 |
RefSeq Size | 1814 |
RefSeq ORF | 1416 |
Synonyms | BDPLT10; CHDS7; FAT; GP3B; GP4; GPIV; PASIV; SCARB3 |
Locus ID | 948 |
UniProt ID | P16671, A4D1B1 |
Cytogenetics | 7q21.11 |
Summary | 'The protein encoded by this gene is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in this gene cause platelet glycoprotein deficiency. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Feb 2014]' |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Adipocytokine signaling pathway, ECM-receptor interaction, Hematopoietic cell lineage, PPAR signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400018 | CD36 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC424372 | CD36 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC424373 | CD36 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC425033 | CD36 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400018 | Transient overexpression lysate of CD36 molecule (thrombospondin receptor) (CD36), transcript variant 3 |
USD 396.00 |
|
LY424372 | Transient overexpression lysate of CD36 molecule (thrombospondin receptor) (CD36), transcript variant 2 |
USD 605.00 |
|
LY424373 | Transient overexpression lysate of CD36 molecule (thrombospondin receptor) (CD36), transcript variant 1 |
USD 605.00 |
|
LY425033 | Transient overexpression lysate of CD36 molecule (thrombospondin receptor) (CD36), transcript variant 2 |
USD 396.00 |
|
PH303254 | CD36 MS Standard C13 and N15-labeled recombinant protein (NP_000063) |
USD 2,055.00 |
|
PH321976 | CD36 MS Standard C13 and N15-labeled recombinant protein (NP_001001548) |
USD 2,055.00 |
|
PH325800 | CD36 MS Standard C13 and N15-labeled recombinant protein (NP_001120916) |
USD 2,055.00 |
|
TP303254 | Recombinant protein of human CD36 molecule (thrombospondin receptor) (CD36), transcript variant 3 |
USD 867.00 |
|
TP321976 | Purified recombinant protein of Homo sapiens CD36 molecule (thrombospondin receptor) (CD36), transcript variant 1 |
USD 823.00 |
|
TP325799 | Purified recombinant protein of Homo sapiens CD36 molecule (thrombospondin receptor) (CD36), transcript variant 4 |
USD 748.00 |
|
TP325800 | Purified recombinant protein of Homo sapiens CD36 molecule (thrombospondin receptor) (CD36), transcript variant 5 |
USD 748.00 |
|
TP710013 | Recombinant protein of human CD36 molecule (thrombospondin receptor) (CD36),full length,with C-terminal polyhistidine tag, expressed in sf9 cell |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review