ARHGEF7 (NM_001113513) Human Mass Spec Standard
CAT#: PH326057
ARHGEF7 MS Standard C13 and N15-labeled recombinant protein (NP_001106985)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC226057 |
Predicted MW | 73 kDa |
Protein Sequence |
>RC226057 representing NM_001113513
Red=Cloning site Green=Tags(s) MTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPV SPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGN LEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTLYLTYCANHPSAVNVLTEHSEELGEFMET KGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRKRKELE LQILTEAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPT TGMTITKLEDSENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLP SHPVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALC YKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSSSRKES APQVLLPEEEKIIVEETKSNGQTVIEEKSLVDTVYALKDEVQELRQDNKKMKKSLEEEQRARKDLEKLVR KVLKNMNDPAWDETNL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001106985 |
RefSeq ORF | 1938 |
Synonyms | BETA-PIX; COOL-1; COOL1; Nbla10314; P50; P50BP; P85; P85COOL1; P85SPR; PAK3; PIXB |
Locus ID | 8874 |
UniProt ID | Q14155, A0A024RDY9 |
Cytogenetics | 13q34 |
Summary | This gene encodes a protein that belongs to a family of cytoplasmic proteins that activate the Ras-like family of Rho proteins by exchanging bound GDP for GTP. It forms a complex with the small GTP binding protein Rac1 and recruits Rac1 to membrane ruffles and to focal adhesions. Multiple alternatively spliced transcript variants encoding different isoforms have been observed for this gene. [provided by RefSeq, Mar 2016] |
Protein Pathways | Regulation of actin cytoskeleton |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407867 | ARHGEF7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC418366 | ARHGEF7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC426426 | ARHGEF7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY407867 | Transient overexpression lysate of Rho guanine nucleotide exchange factor (GEF) 7 (ARHGEF7), transcript variant 2 |
USD 605.00 |
|
LY418366 | Transient overexpression lysate of Rho guanine nucleotide exchange factor (GEF) 7 (ARHGEF7), transcript variant 1 |
USD 605.00 |
|
LY426426 | Transient overexpression lysate of Rho guanine nucleotide exchange factor (GEF) 7 (ARHGEF7), transcript variant 5 |
USD 396.00 |
|
PH318798 | ARHGEF7 MS Standard C13 and N15-labeled recombinant protein (NP_663788) |
USD 2,055.00 |
|
TP318798 | Recombinant protein of human Rho guanine nucleotide exchange factor (GEF) 7 (ARHGEF7), transcript variant 2 |
USD 788.00 |
|
TP326057 | Recombinant protein of human Rho guanine nucleotide exchange factor (GEF) 7 (ARHGEF7), transcript variant 5 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review