ABH2 (ALKBH2) (NM_001145375) Human Mass Spec Standard

CAT#: PH326527

ALKBH2 MS Standard C13 and N15-labeled recombinant protein (NP_001138847)

Product Images

Coomassie blue staining of purified ALKBH2 protein (Cat# TP326527). The protein was produced from HEK293T cells transfected with ALKBH2 cDNA clone (Cat# RC226527) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC226527
• Predicted MW: 29.3 kDa
• Protein Sequence:
  Sequence Link

  >RC226527 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDRFLVKGAQGGLLRKQEEQEPTGEEPAVLGGDKESTRKRPRREAPGNGGHSAGPSWRHIRAEGLDCSYT
  VLFGKAEADEIFQELEKEVEYFTGALARVQVFGKWHSVPRKQATYGDAGLTYTFSGLTLSPKPWIPVLER
  IRDHVSGVTGQTFNFVLINRYKDGCDHIGEHRDDERELAPGSPIASVSFGACRDFVFRHKDSRGKSPSRR
  VAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRKILLTKK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001138847
• RefSeq Size: 953
• RefSeq ORF: 783
• Synonyms: ABH2
• Locus ID: 121642
• UniProt ID: Q6NS38
• Cytogenetics: 12q24.11
• Summary: The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 and ALKBH3 (MIM 610603) are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine (Duncan et al., 2002 [PubMed 12486230]). [supplied by OMIM, Mar 2008]
• Protein Families: Druggable Genome