ABH2 (ALKBH2) (NM_001145375) Human Mass Spec Standard
CAT#: PH326527
ALKBH2 MS Standard C13 and N15-labeled recombinant protein (NP_001138847)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC226527 |
Predicted MW | 29.3 kDa |
Protein Sequence |
>RC226527 protein sequence
Red=Cloning site Green=Tags(s) MDRFLVKGAQGGLLRKQEEQEPTGEEPAVLGGDKESTRKRPRREAPGNGGHSAGPSWRHIRAEGLDCSYT VLFGKAEADEIFQELEKEVEYFTGALARVQVFGKWHSVPRKQATYGDAGLTYTFSGLTLSPKPWIPVLER IRDHVSGVTGQTFNFVLINRYKDGCDHIGEHRDDERELAPGSPIASVSFGACRDFVFRHKDSRGKSPSRR VAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRKILLTKK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001138847 |
RefSeq Size | 953 |
RefSeq ORF | 783 |
Synonyms | ABH2 |
Locus ID | 121642 |
UniProt ID | Q6NS38 |
Cytogenetics | 12q24.11 |
Summary | The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 and ALKBH3 (MIM 610603) are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine (Duncan et al., 2002 [PubMed 12486230]). [supplied by OMIM, Mar 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400362 | ALKBH2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC428853 | ALKBH2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC428854 | ALKBH2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400362 | Transient overexpression lysate of alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 2 |
USD 325.00 |
|
LY428853 | Transient overexpression lysate of alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 1 |
USD 325.00 |
|
LY428854 | Transient overexpression lysate of alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 3 |
USD 325.00 |
|
PH310103 | ALKBH2 MS Standard C13 and N15-labeled recombinant protein (NP_001001655) |
USD 2,055.00 |
|
PH326507 | ALKBH2 MS Standard C13 and N15-labeled recombinant protein (NP_001138846) |
USD 2,055.00 |
|
TP310103 | Recombinant protein of human alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 2 |
USD 823.00 |
|
TP326507 | Recombinant protein of human alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 1 |
USD 748.00 |
|
TP326527 | Recombinant protein of human alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review