DAXX (NM_001141969) Human Mass Spec Standard
CAT#: PH326603
DAXX MS Standard C13 and N15-labeled recombinant protein (NP_001135441)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC226603 |
| Predicted MW | 81.4 kDa |
| Protein Sequence |
>RC226603 protein sequence
Red=Cloning site Green=Tags(s) MATANSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGSSSSGGKKCYKLENEKLFEEF LELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAK KKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTRGSRRQIQRLEQLLALYVAEIRRLQEKEL DLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGP DTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDP ALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKSEEGERKKRRARLQGTSSHSADTPEASLDSGEGPS GMASQGCPSASRAETDDEDDEESDEEEEEEEEEEEEEATDSEEEEDLEQMQEGQEDDEEEDEEEEAAAGK DGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGEQPEELTLEEE SPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSGPPCK KSRKEKKQTGSGPLGNSYVERQRSVHEKNGKKICTLPSPPSPLASLAPVADSSTRVDSPSHGLVTSSLCI PSPARLSQTPHSQPPRPGTCKTSVATQCDPEEIIVLSDSD myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_001135441 |
| RefSeq Size | 2632 |
| RefSeq ORF | 2220 |
| Synonyms | BING2; DAP6; EAP1; SMIM40 |
| Locus ID | 1616 |
| UniProt ID | Q9UER7, A0A024RCS3, Q53F85 |
| Cytogenetics | 6p21.32 |
| Summary | 'This gene encodes a multifunctional protein that resides in multiple locations in the nucleus and in the cytoplasm. It interacts with a wide variety of proteins, such as apoptosis antigen Fas, centromere protein C, and transcription factor erythroblastosis virus E26 oncogene homolog 1. In the nucleus, the encoded protein functions as a potent transcription repressor that binds to sumoylated transcription factors. Its repression can be relieved by the sequestration of this protein into promyelocytic leukemia nuclear bodies or nucleoli. This protein also associates with centromeres in G2 phase. In the cytoplasm, the encoded protein may function to regulate apoptosis. The subcellular localization and function of this protein are modulated by post-translational modifications, including sumoylation, phosphorylation and polyubiquitination. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2008]' |
| Protein Families | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
| Protein Pathways | Amyotrophic lateral sclerosis (ALS), MAPK signaling pathway |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400540 | DAXX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC427986 | DAXX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC427987 | DAXX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LY400540 | Transient overexpression lysate of death-domain associated protein (DAXX), transcript variant 2 |
USD 665.00 |
|
| LY427986 | Transient overexpression lysate of death-domain associated protein (DAXX), transcript variant 1 |
USD 665.00 |
|
| LY427987 | Transient overexpression lysate of death-domain associated protein (DAXX), transcript variant 3 |
USD 665.00 |
|
| PH319497 | DAXX MS Standard C13 and N15-labeled recombinant protein (NP_001341) |
USD 2,055.00 |
|
| PH327435 | DAXX MS Standard C13 and N15-labeled recombinant protein (NP_001135442) |
USD 2,055.00 |
|
| TP319497 | Recombinant protein of human death-domain associated protein (DAXX), transcript variant 2 |
USD 788.00 |
|
| TP326603 | Recombinant protein of human death-domain associated protein (DAXX), transcript variant 1 |
USD 748.00 |
|
| TP327435 | Recombinant protein of human death-domain associated protein (DAXX), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China