TXNL4B (NM_001142318) Human Mass Spec Standard
CAT#: PH326616
TXNL4B MS Standard C13 and N15-labeled recombinant protein (NP_001135790)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC226616 |
Predicted MW | 17 kDa |
Protein Sequence |
>RC226616 protein sequence
Red=Cloning site Green=Tags(s) MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYT QYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIP KYDLLYQDI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001135790 |
RefSeq Size | 2412 |
RefSeq ORF | 447 |
Synonyms | Dim2; DLP |
Locus ID | 54957 |
UniProt ID | Q9NX01 |
Cytogenetics | 16q22.2 |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413417 | TXNL4B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428035 | TXNL4B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428036 | TXNL4B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY413417 | Transient overexpression lysate of thioredoxin-like 4B (TXNL4B), transcript variant 1 |
USD 396.00 |
|
LY428035 | Transient overexpression lysate of thioredoxin-like 4B (TXNL4B), transcript variant 2 |
USD 396.00 |
|
LY428036 | Transient overexpression lysate of thioredoxin-like 4B (TXNL4B), transcript variant 3 |
USD 396.00 |
|
PH301503 | TXNL4B MS Standard C13 and N15-labeled recombinant protein (NP_060323) |
USD 2,055.00 |
|
TP301503 | Recombinant protein of human thioredoxin-like 4B (TXNL4B), transcript variant 1 |
USD 823.00 |
|
TP326616 | Recombinant protein of human thioredoxin-like 4B (TXNL4B), transcript variant 3 |
USD 748.00 |
|
TP761241 | Purified recombinant protein of Human thioredoxin-like 4B (TXNL4B), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review