Glutathione S Transferase kappa 1 (GSTK1) (NM_001143681) Human Mass Spec Standard

CAT#: PH326807

GSTK1 MS Standard C13 and N15-labeled recombinant protein (NP_001137153)

Product Images

Coomassie blue staining of purified GSTK1 protein (Cat# TP326807). The protein was produced from HEK293T cells transfected with GSTK1 cDNA clone (Cat# RC226807) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC226807
• Predicted MW: 20.4 kDa
• Protein Sequence:
  Sequence Link

  >RC226807 representing NM_001143681
  Red=Cloning site Green=Tags(s)
  
  MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGSLSAMRFLTAVNLEHPEM
  LEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGL
  PITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001137153
• RefSeq ORF: 549
• Synonyms: GST; GST13; GST 13-13; GST13-13; GSTK1-1; hGSTK1
• Locus ID: 373156
• UniProt ID: Q9Y2Q3
• Cytogenetics: 7q34
• Summary: This gene encodes a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. The encoded protein is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2009]
• Protein Pathways: Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450