RNASEH2B (NM_001142279) Human Mass Spec Standard
CAT#: PH326833
RNASEH2B MS Standard C13 and N15-labeled recombinant protein (NP_001135751)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC226833 |
Predicted MW | 28.8 kDa |
Protein Sequence |
>RC226833 representing NM_001142279
Red=Cloning site Green=Tags(s) MAAGVDCGDGVGARQHVFLVSEYLKDASKKMKNGLMFVKLVNPCSGEGAIYLFNMCLQQLFEVKVFKEKH HSWFINQSVQSGGLLHFATPVDPLFLLLHYLIKADKEGKFQPLDQVVVDNVFPNCILLLKLPGLEKLLHH VTEEKGNPEIDNKKYYKYSKEKTLKWLEKKVNQTVAALKTNNVNVSSRVQSTAFFSGDQASTDKEEDYIR YAHGLISDYIPKELSDDLSKYLKLPEPSASLPNPPSKMAAQRQKRGK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001135751 |
RefSeq ORF | 771 |
Synonyms | AGS2; DLEU8 |
Locus ID | 79621 |
UniProt ID | Q5TBB1 |
Cytogenetics | 13q14.3 |
Summary | RNase H2 is composed of a single catalytic subunit (A) and two non-catalytic subunits (B and C) and specifically degrades the RNA of RNA:DNA hybrids. The protein encoded by this gene is the non-catalytic B subunit of RNase H2, which is thought to play a role in DNA replication. Multiple transcript variants encoding different isoforms have been found for this gene. Defects in this gene are a cause of Aicardi-Goutieres syndrome type 2 (AGS2). [provided by RefSeq, Nov 2008] |
Protein Pathways | DNA replication |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411236 | RNASEH2B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC428003 | RNASEH2B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY411236 | Transient overexpression lysate of ribonuclease H2, subunit B (RNASEH2B), transcript variant 1 |
USD 325.00 |
|
LY428003 | Transient overexpression lysate of ribonuclease H2, subunit B (RNASEH2B), transcript variant 2 |
USD 325.00 |
|
TP326833 | Recombinant protein of human ribonuclease H2, subunit B (RNASEH2B), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review