TMEM169 (NM_001142310) Human Mass Spec Standard
CAT#: PH327010
TMEM169 MS Standard C13 and N15-labeled recombinant protein (NP_001135782)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC227010 |
Predicted MW | 33.6 kDa |
Protein Sequence |
>RC227010 protein sequence
Red=Cloning site Green=Tags(s) MEEPTAVEGQVQLPSPHQGSLRKAVAAALALDGESTMGHRKKKRKESRPESIIIYRSDNEKTDEEPGESE GGDQPKEEEGDDFLDYPVDDDMWNLPLDSRYVTLTGTITRGKKKGQMVDIHVTLTEKELQELTKPKESSR ETTPEGRMACQMGADRGPHVVLWTLICLPVVFILSFVVSFYYGTITWYNIFLVYNEERTFWHKISYCPCL VLFYPVLIMAMASSLGLYAAVVQLSWSWEAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLESDNIS STLSNKDPIQEVETSTV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001135782 |
RefSeq Size | 3477 |
RefSeq ORF | 891 |
Synonyms | DKFZp781L2456; FLJ34263 |
Locus ID | 92691 |
UniProt ID | Q96HH4, A0A024R430 |
Cytogenetics | 2q35 |
Protein Families | Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408654 | TMEM169 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY408654 | Transient overexpression lysate of transmembrane protein 169 (TMEM169), transcript variant 3 |
USD 396.00 |
|
PH303846 | TMEM169 MS Standard C13 and N15-labeled recombinant protein (NP_612399) |
USD 2,055.00 |
|
PH327014 | TMEM169 MS Standard C13 and N15-labeled recombinant protein (NP_001135783) |
USD 2,055.00 |
|
PH327027 | TMEM169 MS Standard C13 and N15-labeled recombinant protein (NP_001135784) |
USD 2,055.00 |
|
TP303846 | Recombinant protein of human transmembrane protein 169 (TMEM169), transcript variant 3 |
USD 823.00 |
|
TP327010 | Purified recombinant protein of Homo sapiens transmembrane protein 169 (TMEM169), transcript variant 1 |
USD 748.00 |
|
TP327014 | Purified recombinant protein of Homo sapiens transmembrane protein 169 (TMEM169), transcript variant 2 |
USD 748.00 |
|
TP327027 | Purified recombinant protein of Homo sapiens transmembrane protein 169 (TMEM169), transcript variant 4 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review