RAB7L1 (RAB29) (NM_001135662) Human Mass Spec Standard

CAT#: PH327093

RAB7L1 MS Standard C13 and N15-labeled recombinant protein (NP_001129134)

Product Images

Coomassie blue staining of purified RAB29 protein (Cat# TP327093). The protein was produced from HEK293T cells transfected with RAB29 cDNA clone (Cat# RC227093) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC227093
• Predicted MW: 23.2 kDa
• Protein Sequence:
  Sequence Link

  >RC227093 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERF
  TSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQID
  RFSKENGFTGWTETSVKENKNINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKSSSWSCC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001129134
• RefSeq Size: 3223
• RefSeq ORF: 609
• Synonyms: RAB7L; RAB7L1
• Locus ID: 8934
• UniProt ID: O14966, Q6FGU7, B2R7I9
• Cytogenetics: 1q32.1
• Protein Families: Druggable Genome