WIBG (PYM1) (NM_001143853) Human Mass Spec Standard
CAT#: PH327106
WIBG MS Standard C13 and N15-labeled recombinant protein (NP_001137325)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC227106 |
| Predicted MW | 22.5 kDa |
| Protein Sequence |
>RC227106 representing NM_001143853
Red=Cloning site Green=Tags(s) MATPYVTDETGGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELPPGLSPEATAPV TPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDKVSLEETAQLPSAPQGSRAAPTAASDQ PDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPSKEQLEKLARRRALEEELEDLELGL myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_001137325 |
| RefSeq ORF | 609 |
| Synonyms | PYM; WIBG |
| Locus ID | 84305 |
| UniProt ID | Q9BRP8 |
| Cytogenetics | 12q13.2 |
| Summary | Key regulator of the exon junction complex (EJC), a multiprotein complex that associates immediately upstream of the exon-exon junction on mRNAs and serves as a positional landmark for the intron exon structure of genes and directs post-transcriptional processes in the cytoplasm such as mRNA export, nonsense-mediated mRNA decay (NMD) or translation. Acts as an EJC disassembly factor, allowing translation-dependent EJC removal and recycling by disrupting mature EJC from spliced mRNAs. Its association with the 40S ribosomal subunit probably prevents a translation-independent disassembly of the EJC from spliced mRNAs, by restricting its activity to mRNAs that have been translated. Interferes with NMD and enhances translation of spliced mRNAs, probably by antagonizing EJC functions. May bind RNA; the relevance of RNA-binding remains unclear in vivo, RNA-binding was detected by PubMed:14968132, while PubMed:19410547 did not detect RNA-binding activity independently of the EJC. [UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410182 | WIBG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC428389 | WIBG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY410182 | Transient overexpression lysate of within bgcn homolog (Drosophila) (WIBG), transcript variant 1 |
USD 436.00 |
|
| LY428389 | Transient overexpression lysate of within bgcn homolog (Drosophila) (WIBG), transcript variant 2 |
USD 436.00 |
|
| PH302988 | WIBG MS Standard C13 and N15-labeled recombinant protein (NP_115721) |
USD 2,055.00 |
|
| TP302988 | Recombinant protein of human within bgcn homolog (Drosophila) (WIBG), transcript variant 1 |
USD 823.00 |
|
| TP327106 | Recombinant protein of human within bgcn homolog (Drosophila) (WIBG), transcript variant 2 |
USD 748.00 |
|
| TP720529 | Recombinant protein of human within bgcn homolog (Drosophila) (WIBG), transcript variant 2 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China